PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_15927.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 317aa    MW: 35718.5 Da    PI: 8.3874
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_15927.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM98.87.7e-3157954128
                      NAM  54 eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              +ekewyf+++rd+ky++g+r+nr+t+sgyWkatg d+++ s++ + +glkktLvfy+g+apkg++t+W+m+eyrl
  Rsa1.0_15927.1_g00001.1   5 GEKEWYFYVPRDRKYRNGDRPNRVTTSGYWKATGADRTIRSESARPIGLKKTLVFYSGKAPKGTRTSWIMNEYRL 79 
                              689**********************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100538.6631100IPR003441NAC domain
SuperFamilySSF1019411.44E-343100IPR003441NAC domain
PfamPF023655.1E-13979IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MAAIGEKEWY FYVPRDRKYR NGDRPNRVTT SGYWKATGAD RTIRSESARP IGLKKTLVFY  60
SGKAPKGTRT SWIMNEYRLP HHETEKYQKA EISLCRVYKR PGVEDHSSLP RSLSTRHHNH  120
TSSSSLLALR QQQQQHHSSS SNHLDNNNLE KLSTEYSGDG STITTINRNS DVNQTIYNPL  180
TTTIPLANQN IYHPLPYGAS NTPMISTSNK EDDETAIVDD LQRLVNYQIS DGGSNINHQY  240
YQVAQQFHNQ QQLNANALQL VAAATTAALA PQTQAALAMS MVPAGTTPNT ALWDLWNPLL  300
PDGNRDHYTN ALFEEFN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A6e-36210066165NO APICAL MERISTEM PROTEIN
1ut4_B6e-36210066165NO APICAL MERISTEM PROTEIN
1ut7_A6e-36210066165NO APICAL MERISTEM PROTEIN
1ut7_B6e-36210066165NO APICAL MERISTEM PROTEIN
3swm_A6e-36210069168NAC domain-containing protein 19
3swm_B6e-36210069168NAC domain-containing protein 19
3swm_C6e-36210069168NAC domain-containing protein 19
3swm_D6e-36210069168NAC domain-containing protein 19
3swp_A6e-36210069168NAC domain-containing protein 19
3swp_B6e-36210069168NAC domain-containing protein 19
3swp_C6e-36210069168NAC domain-containing protein 19
3swp_D6e-36210069168NAC domain-containing protein 19
4dul_A6e-36210066165NAC domain-containing protein 19
4dul_B6e-36210066165NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1894521e-153AC189452.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB072E02, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013713099.10.0PREDICTED: NAC domain-containing protein 72-like
TrEMBLA0A078EU730.0A0A078EU73_BRANA; BnaA09g19070D protein
STRINGBra017416.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM54362750
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.21e-116NAC domain containing protein 35